主要实体瘤新抗原HLA热点

随着肿瘤新生抗原肿瘤mRNA疫苗、TCR-T疗法等肿瘤免疫方向普及,很多用户询问各种肿瘤的HLA选择策略。为了回答好这个问题,我们分析了83篇肿瘤免疫研究的高引用文献,列出了7种肿瘤相关的热点HLA类型。这些HLA及其呈递的抗原肽经过T细胞活化四聚体流式定量检测等验证。

实体瘤新抗原HLA热点类型

根据83篇论文统计的主要HLA类型,圆圈颜色代表HLA呈递的多肽种类,棕色圆圈HLA在对应肿瘤呈递多肽数量大于20个,黄色圆圈HLAHLA在对应肿瘤呈递多肽数量介于10-20个,红色圆圈HLA在对应肿瘤呈递多肽数量<10个

从上图可见,A0201、A2402、A1101、A0206、C0304共5种HLA涉及3种以上肿瘤类型,这可能是由于这些HLA是人群分布的主要HLA类型所致(参考中国人HLA类型分布特征)。

不同肿瘤文献名称与HLA类型对应表 (均有现货出售)

下表可以在搜索框中输入疾病名称、感兴趣关键词查询相关信息:

文章名称多肽序列MHC肿瘤类型
Selective accumulation of differentiated CD8+ T cells specific for respiratory viruses in the human lung...J Exp Med.2005YLEKESIYYHLA-A*01:01Lung Cancer
T-cell response to human papillomavirus type 58 L1, E6, And E7 peptides in women with cleared infection, cervical intraepithelial neoplasia, or invasive cancer..Clin Vaccine Immunol.2010AVPDDLYIKHLA-A*11:01Cervical Cancer
Serine Proteases Enhance Immunogenic Antigen Presentation on Lung Cancer Cells...Cancer Immunol Res.2017LLSAVLPSVHLA-A*02:01Lung Cancer
Serine Proteases Enhance Immunogenic Antigen Presentation on Lung Cancer Cells...Cancer Immunol Res.2017ALIGGPPVHLA-A*02:01Lung Cancer
Serine Proteases Enhance Immunogenic Antigen Presentation on Lung Cancer Cells...Cancer Immunol Res.2017LLLELAGVTHVHLA-A*02:01Lung Cancer
An Isolated TCR alphabeta Restricted by HLA-A*02:01/CT37 Peptide Redirecting CD8+T Cells To Kill and Secrete IFN-gamma in Response to Lung Adenocarcinoma Cell Lines...J Immunol.2018YLCSGSSYFVHLA-A*02:01Lung Cancer
An Isolated TCR alphabeta Restricted by HLA-A*02:01/CT37 Peptide Redirecting CD8+T Cells To Kill and Secrete IFN-gamma in Response to Lung Adenocarcinoma Cell Lines...J Immunol.2018YLCSGSSYFHLA-A*02:01Lung Cancer
An Isolated TCR alphabeta Restricted by HLA-A*02:01/CT37 Peptide Redirecting CD8+T Cells To Kill and Secrete IFN-gamma in Response to Lung Adenocarcinoma Cell Lines...J Immunol.2018LIMQLMPFGCLHLA-A*02:01Lung Cancer
Human preprocalcitonin self-antigen generates TAP-dependent and -independent epitopes triggering optimised T-cell responses toward immune-escaped tumours...Nat Commun.2018FLALSILVLHLA-A*02:01Lung Cancer
Human preprocalcitonin self-antigen generates TAP-dependent and -independent epitopes triggering optimised T-cell responses toward immune-escaped tumours...Nat Commun.2018VLLQAGSLHAHLA-A*02:01Lung Cancer
Human preprocalcitonin self-antigen generates TAP-dependent and -independent epitopes triggering optimised T-cell responses toward immune-escaped tumours...Nat Commun.2018LLAALVQDYLHLA-A*02:01Lung Cancer
Human preprocalcitonin self-antigen generates TAP-dependent and -independent epitopes triggering optimised T-cell responses toward immune-escaped tumours...Nat Commun.2018CMLGTYTQDFHLA-A*02:01Lung Cancer
Human preprocalcitonin self-antigen generates TAP-dependent and -independent epitopes triggering optimised T-cell responses toward immune-escaped tumours...Nat Commun.2018ELAGIGILTVHLA-A*02:01Lung Cancer
The Mutation-Associated Neoantigen Functional Expansion of Specific T Cells (MANAFEST) Assay: A Sensitive Platform for Monitoring Antitumor Immunity...Cancer Immunol Res.2018EVQQFLRYHLA-A*25:01Lung Cancer
The Mutation-Associated Neoantigen Functional Expansion of Specific T Cells (MANAFEST) Assay: A Sensitive Platform for Monitoring Antitumor Immunity...Cancer Immunol Res.2018EVIVPLSGWHLA-A*25:01Lung Cancer
The Mutation-Associated Neoantigen Functional Expansion of Specific T Cells (MANAFEST) Assay: A Sensitive Platform for Monitoring Antitumor Immunity...Cancer Immunol Res.2018ETMQCSELYHMHLA-A*25:01Lung Cancer
The Mutation-Associated Neoantigen Functional Expansion of Specific T Cells (MANAFEST) Assay: A Sensitive Platform for Monitoring Antitumor Immunity...Cancer Immunol Res.2018QHQPNPFEVHLA-B*38:01Lung Cancer
Human preprocalcitonin self-antigen generates TAP-dependent and -independent epitopes triggering optimised T-cell responses toward immune-escaped tumours...Nat Commun.2018MGFQKFSPFLALSILHLA-A*02:01Lung Cancer
Human preprocalcitonin self-antigen generates TAP-dependent and -independent epitopes triggering optimised T-cell responses toward immune-escaped tumours...Nat Commun.2018GNLSTCMLGTYTQDFHLA-A*02:01Lung Cancer
Rapid tumor regression in an Asian lung cancer patient following personalized neo-epitope peptide vaccination...Oncoimmunology.2016HVKITDFGRHLA-A*31:01Lung Cancer
Rapid tumor regression in an Asian lung cancer patient following personalized neo-epitope peptide vaccination...Oncoimmunology.2016KITDFGRAKHLA-A*11:01Lung Cancer
Rapid tumor regression in an Asian lung cancer patient following personalized neo-epitope peptide vaccination...Oncoimmunology.2016HVKITDFGRAKHLA-A*31:01Lung Cancer
Rapid tumor regression in an Asian lung cancer patient following personalized neo-epitope peptide vaccination...Oncoimmunology.2016RAKLLGAEEKHLA-A*31:01Lung Cancer
Rapid tumor regression in an Asian lung cancer patient following personalized neo-epitope peptide vaccination...Oncoimmunology.2016RATVAPRSLHLA-C*03:03Lung Cancer
Rapid tumor regression in an Asian lung cancer patient following personalized neo-epitope peptide vaccination...Oncoimmunology.2016VTIGPRLLLHLA-C*03:03Lung Cancer
Rapid tumor regression in an Asian lung cancer patient following personalized neo-epitope peptide vaccination...Oncoimmunology.2016QPSGIILDYHLA-B*35:01Lung Cancer
Cancer immunology. Mutational landscape determines sensitivity to PD-1 blockade in non-small cell lung cancer...Science.2015ASNASSAAKHLA-A*11:01Lung Cancer
TruNeo: an integrated pipeline improves personalized true tumor neoantigen identification...BMC Bioinformatics.2020SEIISFKSLHLA-B*40:01Lung Cancer
TruNeo: an integrated pipeline improves personalized true tumor neoantigen identification...BMC Bioinformatics.2020SEHGFGPSLHLA-B*40:01Lung Cancer
TruNeo: an integrated pipeline improves personalized true tumor neoantigen identification...BMC Bioinformatics.2020VEWLGRCILHLA-B*40:01Lung Cancer
TruNeo: an integrated pipeline improves personalized true tumor neoantigen identification...BMC Bioinformatics.2020REEKIHDLALHLA-B*40:01Lung Cancer
TruNeo: an integrated pipeline improves personalized true tumor neoantigen identification...BMC Bioinformatics.2020SSEIISFKSLHLA-B*40:01Lung Cancer
TruNeo: an integrated pipeline improves personalized true tumor neoantigen identification...BMC Bioinformatics.2020ATSPASASKHLA-A*11:01Lung Cancer
TruNeo: an integrated pipeline improves personalized true tumor neoantigen identification...BMC Bioinformatics.2020MLICCCCTLHLA-A*02:10Lung Cancer
Late-differentiated effector neoantigen-specific CD8+ T cells are enriched in peripheral blood of non-small cell lung carcinoma patients responding to atezolizumab treatment...J Immunother Cancer.2019YHMYIFPVHLA-A*02:01Lung Cancer
Late-differentiated effector neoantigen-specific CD8+ T cells are enriched in peripheral blood of non-small cell lung carcinoma patients responding to atezolizumab treatment...J Immunother Cancer.2019RLDSTLLLYHLA-A*03:01Lung Cancer
Late-differentiated effector neoantigen-specific CD8+ T cells are enriched in peripheral blood of non-small cell lung carcinoma patients responding to atezolizumab treatment...J Immunother Cancer.2019RVFDEQYSKKHLA-A*03:01Lung Cancer
Late-differentiated effector neoantigen-specific CD8+ T cells are enriched in peripheral blood of non-small cell lung carcinoma patients responding to atezolizumab treatment...J Immunother Cancer.2019ILPDAGQTVHLA-A*02:01Lung Cancer
Late-differentiated effector neoantigen-specific CD8+ T cells are enriched in peripheral blood of non-small cell lung carcinoma patients responding to atezolizumab treatment...J Immunother Cancer.2019LLVDAMHNQLHLA-A*02:01Lung Cancer
Late-differentiated effector neoantigen-specific CD8+ T cells are enriched in peripheral blood of non-small cell lung carcinoma patients responding to atezolizumab treatment...J Immunother Cancer.2019MLLENKAVEKAHLA-A*02:01Lung Cancer
Late-differentiated effector neoantigen-specific CD8+ T cells are enriched in peripheral blood of non-small cell lung carcinoma patients responding to atezolizumab treatment...J Immunother Cancer.2019SVQDVSLFVHLA-A*02:01Lung Cancer
Late-differentiated effector neoantigen-specific CD8+ T cells are enriched in peripheral blood of non-small cell lung carcinoma patients responding to atezolizumab treatment...J Immunother Cancer.2019SLLTNWPFVHLA-A*02:01Lung Cancer
Late-differentiated effector neoantigen-specific CD8+ T cells are enriched in peripheral blood of non-small cell lung carcinoma patients responding to atezolizumab treatment...J Immunother Cancer.2019FMQRLLGPQRVHLA-A*02:01Lung Cancer
Late-differentiated effector neoantigen-specific CD8+ T cells are enriched in peripheral blood of non-small cell lung carcinoma patients responding to atezolizumab treatment...J Immunother Cancer.2019TIQKFLSLKHLA-A*03:01Lung Cancer
Late-differentiated effector neoantigen-specific CD8+ T cells are enriched in peripheral blood of non-small cell lung carcinoma patients responding to atezolizumab treatment...J Immunother Cancer.2019CISNVFMQRHLA-A*03:01Lung Cancer
Late-differentiated effector neoantigen-specific CD8+ T cells are enriched in peripheral blood of non-small cell lung carcinoma patients responding to atezolizumab treatment...J Immunother Cancer.2019MLLENKAVEKHLA-A*03:01Lung Cancer
Late-differentiated effector neoantigen-specific CD8+ T cells are enriched in peripheral blood of non-small cell lung carcinoma patients responding to atezolizumab treatment...J Immunother Cancer.2019RVIHLLVEKHLA-A*03:01Lung Cancer
Late-differentiated effector neoantigen-specific CD8+ T cells are enriched in peripheral blood of non-small cell lung carcinoma patients responding to atezolizumab treatment...J Immunother Cancer.2019FLSNFIILMLHLA-A*02:01Lung Cancer
Late-differentiated effector neoantigen-specific CD8+ T cells are enriched in peripheral blood of non-small cell lung carcinoma patients responding to atezolizumab treatment...J Immunother Cancer.2019RLSCMLARLEVHLA-A*02:01Lung Cancer
Late-differentiated effector neoantigen-specific CD8+ T cells are enriched in peripheral blood of non-small cell lung carcinoma patients responding to atezolizumab treatment...J Immunother Cancer.2019LLLASTSGAHLA-A*02:01Lung Cancer
Late-differentiated effector neoantigen-specific CD8+ T cells are enriched in peripheral blood of non-small cell lung carcinoma patients responding to atezolizumab treatment...J Immunother Cancer.2019MMDYPYPTNFLHLA-A*02:01Lung Cancer
Late-differentiated effector neoantigen-specific CD8+ T cells are enriched in peripheral blood of non-small cell lung carcinoma patients responding to atezolizumab treatment...J Immunother Cancer.2019TMIEEYDSGLHLA-A*02:01Lung Cancer
Late-differentiated effector neoantigen-specific CD8+ T cells are enriched in peripheral blood of non-small cell lung carcinoma patients responding to atezolizumab treatment...J Immunother Cancer.2019GIKFVKHLGKHLA-A*03:01Lung Cancer
Late-differentiated effector neoantigen-specific CD8+ T cells are enriched in peripheral blood of non-small cell lung carcinoma patients responding to atezolizumab treatment...J Immunother Cancer.2019GLIPFFMVVHLA-A*02:01Lung Cancer
Late-differentiated effector neoantigen-specific CD8+ T cells are enriched in peripheral blood of non-small cell lung carcinoma patients responding to atezolizumab treatment...J Immunother Cancer.2019KLVVVGACGVHLA-A*02:01Lung Cancer
Late-differentiated effector neoantigen-specific CD8+ T cells are enriched in peripheral blood of non-small cell lung carcinoma patients responding to atezolizumab treatment...J Immunother Cancer.2019TMIEEYDSGHLA-A*02:01Lung Cancer
Late-differentiated effector neoantigen-specific CD8+ T cells are enriched in peripheral blood of non-small cell lung carcinoma patients responding to atezolizumab treatment...J Immunother Cancer.2019RLDSTLLLYHLA-A*02:01Lung Cancer
Personal Neoantigens From Patients With NSCLC Induce Efficient Antitumor Responses...Front Oncol.2021QLRENFQEKRQWLFKYQSLLRMFLSYCHLA-B*15:02Lung Cancer
Personal Neoantigens From Patients With NSCLC Induce Efficient Antitumor Responses...Front Oncol.2021SAPFLASAVSAQPLLPDQCPALCECSEHLA-A*02:06Lung Cancer
Personal Neoantigens From Patients With NSCLC Induce Efficient Antitumor Responses...Front Oncol.2021RYPWARLYSTSQTAVDSGEVKTFLALAHLA-A*02:06Lung Cancer
Personal Neoantigens From Patients With NSCLC Induce Efficient Antitumor Responses...Front Oncol.2021SSQHASRGGQSDDYEDEGVPASYHTVSHLA-B*15:01Lung Cancer
Personal Neoantigens From Patients With NSCLC Induce Efficient Antitumor Responses...Front Oncol.2021GSQDSGAPGEAMETLGRAQRCDDSPAPHLA-A*33:03Lung Cancer
Personal Neoantigens From Patients With NSCLC Induce Efficient Antitumor Responses...Front Oncol.2021QDVWMRSRADNKPYLSFSEPENAVSEIHLA-B*58:01Lung Cancer
Personal Neoantigens From Patients With NSCLC Induce Efficient Antitumor Responses...Front Oncol.2021QTDVGGSGLSRLDISVIFEALATGCTSHLA-A*02:01Lung Cancer
Personal Neoantigens From Patients With NSCLC Induce Efficient Antitumor Responses...Front Oncol.2021VLLSWKVLDFSGPVPQGTGQPCSCGHWHLA-A*02:01Lung Cancer
Personal Neoantigens From Patients With NSCLC Induce Efficient Antitumor Responses...Front Oncol.2021KYAVAVGSLCALSSSLLGSMFPMPRVIHLA-A*02:01Lung Cancer
Personal Neoantigens From Patients With NSCLC Induce Efficient Antitumor Responses...Front Oncol.2021SIEDHCSIAQQRNLAQYFKKVLGDTLLHLA-A*02:01Lung Cancer
Personal Neoantigens From Patients With NSCLC Induce Efficient Antitumor Responses...Front Oncol.2021ILDASKQRHNKLWCQQTDSSLQQPVDDHLA-A*02:01Lung Cancer
Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification...Nat Biotechnol.2018GTKKDVDVLKHLA-A*03:01Lung Cancer
Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification...Nat Biotechnol.2018QDVSVQVERHLA-A*68:01Lung Cancer
Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification...Nat Biotechnol.2018SSAAAPFPLHLA-C*03:04Lung Cancer
Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification...Nat Biotechnol.2018FVSTSDIKSMHLA-C*03:04Lung Cancer
Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification...Nat Biotechnol.2018YEHEDVKEAHLA-B*49:01Lung Cancer
Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification...Nat Biotechnol.2018DENITTIQFHLA-B*18:01Lung Cancer
Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification...Nat Biotechnol.2018EVADAATLTMHLA-A*26:01Lung Cancer
Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification...Nat Biotechnol.2018DTVEYPYTSFHLA-A*26:01Lung Cancer
Neoantigen vaccination induces clinical and immunologic responses in non-small cell lung cancer patients harboring EGFR mutations...J Immunother Cancer.2021LLKHPFTLMHLA-A*30:01Lung Cancer
Neoantigen vaccination induces clinical and immunologic responses in non-small cell lung cancer patients harboring EGFR mutations...J Immunother Cancer.2021KELLKHPFTLHLA-A*02:01Lung Cancer
Neoantigen vaccination induces clinical and immunologic responses in non-small cell lung cancer patients harboring EGFR mutations...J Immunother Cancer.2021FTLMYEERAVHLA-A*02:01Lung Cancer
Neoantigen vaccination induces clinical and immunologic responses in non-small cell lung cancer patients harboring EGFR mutations...J Immunother Cancer.2021AIKTSPKANKHLA-A*03:01Lung Cancer
Neoantigen vaccination induces clinical and immunologic responses in non-small cell lung cancer patients harboring EGFR mutations...J Immunother Cancer.2021DEVFGSSRLHLA-B*40:01Lung Cancer
Neoantigen vaccination induces clinical and immunologic responses in non-small cell lung cancer patients harboring EGFR mutations...J Immunother Cancer.2021RLDPRMSTLQKHLA-A*11:01Lung Cancer
Neoantigen vaccination induces clinical and immunologic responses in non-small cell lung cancer patients harboring EGFR mutations...J Immunother Cancer.2021YMKSLEFENKHLA-A*11:01Lung Cancer
Neoantigen vaccination induces clinical and immunologic responses in non-small cell lung cancer patients harboring EGFR mutations...J Immunother Cancer.2021KITDFGRAKHLA-A*11:01Lung Cancer
Neoantigen vaccination induces clinical and immunologic responses in non-small cell lung cancer patients harboring EGFR mutations...J Immunother Cancer.2021VKITDFGRAKHLA-A*11:01Lung Cancer
Neoantigen vaccination induces clinical and immunologic responses in non-small cell lung cancer patients harboring EGFR mutations...J Immunother Cancer.2021ITDFGRAKLHLA-C*01:02Lung Cancer
Neoantigen vaccination induces clinical and immunologic responses in non-small cell lung cancer patients harboring EGFR mutations...J Immunother Cancer.2021QEECLWMAVHLA-B*40:02Lung Cancer
Neoantigen vaccination induces clinical and immunologic responses in non-small cell lung cancer patients harboring EGFR mutations...J Immunother Cancer.2021IFQEMFDKHYKHLA-A*33:01Lung Cancer
Neoantigen vaccination induces clinical and immunologic responses in non-small cell lung cancer patients harboring EGFR mutations...J Immunother Cancer.2021HVKITDFGRAKHLA-A*11:01Lung Cancer
Neoantigen vaccination induces clinical and immunologic responses in non-small cell lung cancer patients harboring EGFR mutations...J Immunother Cancer.2021STPLPGTRVRHLA-A*11:01Lung Cancer
Neoantigen vaccination induces clinical and immunologic responses in non-small cell lung cancer patients harboring EGFR mutations...J Immunother Cancer.2021TPLPGTRVRAHLA-B*54:01Lung Cancer
Neoantigen vaccination induces clinical and immunologic responses in non-small cell lung cancer patients harboring EGFR mutations...J Immunother Cancer.2021KARLPVGAYHLA-A*03:01Lung Cancer
Neoantigen vaccination induces clinical and immunologic responses in non-small cell lung cancer patients harboring EGFR mutations...J Immunother Cancer.2021HVKITDFGRHLA-A*31:01Lung Cancer
Neoantigen vaccination induces clinical and immunologic responses in non-small cell lung cancer patients harboring EGFR mutations...J Immunother Cancer.2021RILKVTEFKHLA-A*11:01Lung Cancer
Neoantigen vaccination induces clinical and immunologic responses in non-small cell lung cancer patients harboring EGFR mutations...J Immunother Cancer.2021LRILKVTEFKHLA-A*11:01Lung Cancer
Neoantigen vaccination induces clinical and immunologic responses in non-small cell lung cancer patients harboring EGFR mutations...J Immunother Cancer.2021GLYVFRNERHLA-A*31:01Lung Cancer
Neoantigen vaccination induces clinical and immunologic responses in non-small cell lung cancer patients harboring EGFR mutations...J Immunother Cancer.2021EKTSSGLYVFRHLA-A*31:01Lung Cancer
Neoantigen vaccination induces clinical and immunologic responses in non-small cell lung cancer patients harboring EGFR mutations...J Immunother Cancer.2021LTSTVQLIMHLA-C*15:02Lung Cancer
Neoantigen vaccination induces clinical and immunologic responses in non-small cell lung cancer patients harboring EGFR mutations...J Immunother Cancer.2021IPVAIKTSPKHLA-A*03:01Lung Cancer
Neoantigen vaccination induces clinical and immunologic responses in non-small cell lung cancer patients harboring EGFR mutations...J Immunother Cancer.2021STVQLIMQLHLA-C*15:02Lung Cancer
Neoantigen vaccination induces clinical and immunologic responses in non-small cell lung cancer patients harboring EGFR mutations...J Immunother Cancer.2021VDNPLMCRLHLA-B*37:04Lung Cancer
Neoantigen vaccination induces clinical and immunologic responses in non-small cell lung cancer patients harboring EGFR mutations...J Immunother Cancer.2021YMMMWDCWHAHLA-A*02:01Lung Cancer
Neoantigen vaccination induces clinical and immunologic responses in non-small cell lung cancer patients harboring EGFR mutations...J Immunother Cancer.2021YMMMWDCWHAVHLA-A*02:01Lung Cancer
Neoantigen vaccination induces clinical and immunologic responses in non-small cell lung cancer patients harboring EGFR mutations...J Immunother Cancer.2021YQVSYGFRLHLA-B*37:01Lung Cancer
Neoantigen vaccination induces clinical and immunologic responses in non-small cell lung cancer patients harboring EGFR mutations...J Immunother Cancer.2021KTYQVSYGFRHLA-A*31:01Lung Cancer
Neoantigen vaccination induces clinical and immunologic responses in non-small cell lung cancer patients harboring EGFR mutations...J Immunother Cancer.2021QKTYQVSYGFRHLA-A*31:01Lung Cancer
Neoantigen vaccination induces clinical and immunologic responses in non-small cell lung cancer patients harboring EGFR mutations...J Immunother Cancer.2021AIKESPKANKHLA-A*11:01Lung Cancer
Neoantigen vaccination induces clinical and immunologic responses in non-small cell lung cancer patients harboring EGFR mutations...J Immunother Cancer.2021KVETDAAQPAVQSAFAVHLA-C*15:02Lung Cancer
STEAP, a prostate tumor antigen, is a target of human CD8+ T cells...Cancer Immunol Immunother.2006FLYTLLREVHLA-A*02:01Lung Cancer
A point mutation in the NFYC gene generates an antigenic peptide recognized by autologous cytolytic T lymphocytes on a human squamous cell lung carcinoma...Int J Cancer.2006QQITKTEVHLA-B*52:01Lung Cancer
Identification of Clonal Neoantigens Derived From Driver Mutations in an -Mutated Lung Cancer Patient Benefitting From Anti-PD-1...Front Immunol.2020IPVAIKTSPKHLA-A*11:01Lung Cancer
Identification of Clonal Neoantigens Derived From Driver Mutations in an -Mutated Lung Cancer Patient Benefitting From Anti-PD-1...Front Immunol.2020AIKTSPKANKHLA-A*11:01Lung Cancer
Identification of Clonal Neoantigens Derived From Driver Mutations in an -Mutated Lung Cancer Patient Benefitting From Anti-PD-1...Front Immunol.2020RVRAMTIYKQHLA-A*11:01Lung Cancer
Identification of Clonal Neoantigens Derived From Driver Mutations in an -Mutated Lung Cancer Patient Benefitting From Anti-PD-1...Front Immunol.2020QLLKGVQKKHLA-A*11:01Lung Cancer
Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer...Cancer Discov.2017STPSASPLPVVHLA-C*15:02Lung Cancer
Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer...Cancer Discov.2017SASPLSVVHLA-B*51:02Lung Cancer
Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer...Cancer Discov.2017STPSASPLSVHLA-C*15:02Lung Cancer
Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer...Cancer Discov.2017AFGSAHLFRHLA-A*31:01Lung Cancer
Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer...Cancer Discov.2017VIAFGSAHLFRHLA-A*31:01Lung Cancer
Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer...Cancer Discov.2017ISANAVEQIVHLA-C*15:02Lung Cancer
Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer...Cancer Discov.2017SVKSCKHKEKHLA-A*30:01Lung Cancer
Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer...Cancer Discov.2017KSCKHTEKHLA-A*30:01Lung Cancer
Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer...Cancer Discov.2017YGRKMHQICVLHLA-C*12:03Lung Cancer
Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer...Cancer Discov.2017RMNFFGLLNFRHLA-A*31:01Lung Cancer
Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer...Cancer Discov.2017MNFFGLLNFRHLA-A*31:01Lung Cancer
Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer...Cancer Discov.2017RQWPQRAIRRHLA-A*31:01Lung Cancer
Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer...Cancer Discov.2017RQWPQRAIRHLA-A*31:01Lung Cancer
Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer...Cancer Discov.2017AFLSCICFRHLA-A*31:01Lung Cancer
Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer...Cancer Discov.2017SAFLSCICFRHLA-A*31:01Lung Cancer
Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer...Cancer Discov.2017LLQKLDYYGRHLA-A*31:01Lung Cancer
Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer...Cancer Discov.2017LGYTGYRLRHLA-C*15:02Lung Cancer
Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer...Cancer Discov.2017KARMNNLLLHLA-C*12:02Lung Cancer
Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer...Cancer Discov.2017LGYTGYRLRHLA-C*12:02Lung Cancer
Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer...Cancer Discov.2017STPSASPLSVHLA-C*12:02Lung Cancer
Clonal neoantigens elicit T cell immunoreactivity and sensitivity to immune checkpoint blockade...Science.2016FAFQEYDSFHLA-B*35:01Lung Cancer
Clonal neoantigens elicit T cell immunoreactivity and sensitivity to immune checkpoint blockade...Science.2016LLLDIVAPKHLA-A*11:01Lung Cancer
Clonal neoantigens elicit T cell immunoreactivity and sensitivity to immune checkpoint blockade...Science.2016SPMIVGSPWHLA-B*07:02Lung Cancer
Clonal neoantigens elicit T cell immunoreactivity and sensitivity to immune checkpoint blockade...Science.2016SPMIVGSPRHLA-B*07:02Lung Cancer
Clonal neoantigens elicit T cell immunoreactivity and sensitivity to immune checkpoint blockade...Science.2016GPISGHVLKHLA-A*11:01Lung Cancer
Clonal neoantigens elicit T cell immunoreactivity and sensitivity to immune checkpoint blockade...Science.2016AVFDRKSDAKHLA-A*11:01Lung Cancer
High frequency of cytolytic T lymphocytes directed against a tumor-specific mutated antigen detectable with HLA tetramers in the blood of a lung carcinoma patient with long survival...Cancer Res.2001FLDEFMEGVHLA-A*02:01Lung Cancer
High frequency of cytolytic T lymphocytes directed against a tumor-specific mutated antigen detectable with HLA tetramers in the blood of a lung carcinoma patient with long survival...Cancer Res.2001FLDEFMEAVHLA-A*02:01Lung Cancer
A point mutation in the alpha-actinin-4 gene generates an antigenic peptide recognized by autologous cytolytic T lymphocytes on a human lung carcinoma...Cancer Res.2001FIASNGVKLVHLA-A*02:01Lung Cancer
EGFR T790M mutation as a possible target for immunotherapy; identification of HLA-A*0201-restricted T cell epitopes derived from the EGFR T790M mutation...PLoS One.2013MQLMPFGCLLHLA-A*02:01Lung Cancer
T-cell response to human papillomavirus type 58 L1, E6, And E7 peptides in women with cleared infection, cervical intraepithelial neoplasia, or invasive cancer..Clin Vaccine Immunol.2010KVCLRLLSKHLA-A*11:01Cervical Cancer
T-cell response to human papillomavirus type 58 L1, E6, And E7 peptides in women with cleared infection, cervical intraepithelial neoplasia, or invasive cancer..Clin Vaccine Immunol.2010KCLNEILIRHLA-A*11:01Cervical Cancer
T-cell response to human papillomavirus type 58 L1, E6, And E7 peptides in women with cleared infection, cervical intraepithelial neoplasia, or invasive cancer..Clin Vaccine Immunol.2010ATEVRTLQQHLA-A*11:01Cervical Cancer
Immunological efficacy of glypican-3 peptide vaccine in patients with advanced hepatocellular carcinoma. Oncoimmunology 2017FVGEFFTDVHLA-A*02:01Hepatocellular Carcinoma
Immunological efficacy of glypican-3 peptide vaccine in patients with advanced hepatocellular carcinoma. Oncoimmunology 2017EYILSLEELHLA-A*24:02Hepatocellular Carcinoma
Unique true predicted neoantigens (TPNAs) correlates with anti-tumor immune control in HCC patients. J Transl Med 2018AVMRWGMPLHLA-A*02:01Hepatocellular Carcinoma
Unique true predicted neoantigens (TPNAs) correlates with anti-tumor immune control in HCC patients. J Transl Med 2018VQLEEEYEVHLA-A*02:01Hepatocellular Carcinoma
Unique true predicted neoantigens (TPNAs) correlates with anti-tumor immune control in HCC patients. J Transl Med 2018AVMRWGMPPHLA-A*02:01Hepatocellular Carcinoma
Unique true predicted neoantigens (TPNAs) correlates with anti-tumor immune control in HCC patients. J Transl Med 2018VMLEGEQEAHLA-A*02:01Hepatocellular Carcinoma
Unique true predicted neoantigens (TPNAs) correlates with anti-tumor immune control in HCC patients. J Transl Med 2018VMLEGEQEEHLA-A*02:01Hepatocellular Carcinoma
High-affinity neoantigens correlate with better prognosis and trigger potent antihepatocellular carcinoma (HCC) activity by activating CD39<sup>+</sup>CD8<sup>+</sup> T cells. Gut 2021TLFSALWALHLA-A*02:06Hepatocellular Carcinoma
High-affinity neoantigens correlate with better prognosis and trigger potent antihepatocellular carcinoma (HCC) activity by activating CD39<sup>+</sup>CD8<sup>+</sup> T cells. Gut 2021WVMPVIPALHLA-A*02:06Hepatocellular Carcinoma
High-affinity neoantigens correlate with better prognosis and trigger potent antihepatocellular carcinoma (HCC) activity by activating CD39<sup>+</sup>CD8<sup>+</sup> T cells. Gut 2021RLRKRNEYRHLA-A*31:01Hepatocellular Carcinoma
High-affinity neoantigens correlate with better prognosis and trigger potent antihepatocellular carcinoma (HCC) activity by activating CD39<sup>+</sup>CD8<sup>+</sup> T cells. Gut 2021FLLPSGMALHLA-C*03:04Hepatocellular Carcinoma
High-affinity neoantigens correlate with better prognosis and trigger potent antihepatocellular carcinoma (HCC) activity by activating CD39<sup>+</sup>CD8<sup>+</sup> T cells. Gut 2021LMRDHMPPVHLA-A*02:03Hepatocellular Carcinoma
High-affinity neoantigens correlate with better prognosis and trigger potent antihepatocellular carcinoma (HCC) activity by activating CD39<sup>+</sup>CD8<sup>+</sup> T cells. Gut 2021YMYLRQLFHIHLA-A*02:01Hepatocellular Carcinoma
Non-terminally exhausted tumor-resident memory HBV-specific T cell responses correlate with relapse-free survival in hepatocellular carcinoma. Immunity 2021SPWWNFGSLLHLA-A*24:02Hepatocellular Carcinoma
Non-terminally exhausted tumor-resident memory HBV-specific T cell responses correlate with relapse-free survival in hepatocellular carcinoma. Immunity 2021ATLPPFMCNKHLA-A*11:01Hepatocellular Carcinoma
Non-terminally exhausted tumor-resident memory HBV-specific T cell responses correlate with relapse-free survival in hepatocellular carcinoma. Immunity 2021LQSASMELKHLA-A*11:01Hepatocellular Carcinoma
Non-terminally exhausted tumor-resident memory HBV-specific T cell responses correlate with relapse-free survival in hepatocellular carcinoma. Immunity 2021VVSQIIDKLKHLA-A*11:01Hepatocellular Carcinoma
Non-terminally exhausted tumor-resident memory HBV-specific T cell responses correlate with relapse-free survival in hepatocellular carcinoma. Immunity 2021VRSLLRSHYRHLA-A*11:01Hepatocellular Carcinoma
Non-terminally exhausted tumor-resident memory HBV-specific T cell responses correlate with relapse-free survival in hepatocellular carcinoma. Immunity 2021FYVTETTFQKHLA-A*11:01Hepatocellular Carcinoma
Non-terminally exhausted tumor-resident memory HBV-specific T cell responses correlate with relapse-free survival in hepatocellular carcinoma. Immunity 2021TTFQKNRLFFYHLA-A*11:01Hepatocellular Carcinoma
Non-terminally exhausted tumor-resident memory HBV-specific T cell responses correlate with relapse-free survival in hepatocellular carcinoma. Immunity 2021ALFSVLNYERHLA-A*11:01Hepatocellular Carcinoma
Non-terminally exhausted tumor-resident memory HBV-specific T cell responses correlate with relapse-free survival in hepatocellular carcinoma. Immunity 2021RAWRTFVLRHLA-A*11:01Hepatocellular Carcinoma
Non-terminally exhausted tumor-resident memory HBV-specific T cell responses correlate with relapse-free survival in hepatocellular carcinoma. Immunity 2021STLTDLQPYHLA-A*11:01Hepatocellular Carcinoma
Non-terminally exhausted tumor-resident memory HBV-specific T cell responses correlate with relapse-free survival in hepatocellular carcinoma. Immunity 2021KLFGVLRLKHLA-A*11:01Hepatocellular Carcinoma
Non-terminally exhausted tumor-resident memory HBV-specific T cell responses correlate with relapse-free survival in hepatocellular carcinoma. Immunity 2021RTAQTQLSRHLA-A*11:01Hepatocellular Carcinoma
Non-terminally exhausted tumor-resident memory HBV-specific T cell responses correlate with relapse-free survival in hepatocellular carcinoma. Immunity 2021ITVTKLSQKHLA-A*11:01Hepatocellular Carcinoma
Non-terminally exhausted tumor-resident memory HBV-specific T cell responses correlate with relapse-free survival in hepatocellular carcinoma. Immunity 2021ALGMVLLGAKHLA-A*11:01Hepatocellular Carcinoma
Non-terminally exhausted tumor-resident memory HBV-specific T cell responses correlate with relapse-free survival in hepatocellular carcinoma. Immunity 2021VLVNAIYFKHLA-A*11:01Hepatocellular Carcinoma
Non-terminally exhausted tumor-resident memory HBV-specific T cell responses correlate with relapse-free survival in hepatocellular carcinoma. Immunity 2021GLVLSGVLHKHLA-A*11:01Hepatocellular Carcinoma
Non-terminally exhausted tumor-resident memory HBV-specific T cell responses correlate with relapse-free survival in hepatocellular carcinoma. Immunity 2021AMPFATPMEAHLA-A*02:01Hepatocellular Carcinoma
Non-terminally exhausted tumor-resident memory HBV-specific T cell responses correlate with relapse-free survival in hepatocellular carcinoma. Immunity 2021LLRSFFYVHLA-A*02:01Hepatocellular Carcinoma
Non-terminally exhausted tumor-resident memory HBV-specific T cell responses correlate with relapse-free survival in hepatocellular carcinoma. Immunity 2021FLYAPTILLWHLA-A*02:01Hepatocellular Carcinoma
Non-terminally exhausted tumor-resident memory HBV-specific T cell responses correlate with relapse-free survival in hepatocellular carcinoma. Immunity 2021KYEAMTKLGFHLA-A*24:02Hepatocellular Carcinoma
Non-terminally exhausted tumor-resident memory HBV-specific T cell responses correlate with relapse-free survival in hepatocellular carcinoma. Immunity 2021KWVESIFLIFHLA-A*24:02Hepatocellular Carcinoma
Development of antigen-prediction algorithm for personalized neoantigen vaccine using human leukocyte antigen transgenic mouse. Cancer Sci 2022YPTVKQICKLHLA-B*07:02Hepatocellular Carcinoma
Development of antigen-prediction algorithm for personalized neoantigen vaccine using human leukocyte antigen transgenic mouse. Cancer Sci 2022LLMMTIASVHLA-A*02:07Hepatocellular Carcinoma
Development of antigen-prediction algorithm for personalized neoantigen vaccine using human leukocyte antigen transgenic mouse. Cancer Sci 2022TLMTATVTTHLA-A*02:07Hepatocellular Carcinoma
Immunogenicity of somatic mutations in human gastrointestinal cancers. Science 2015MTEYKLVVVGADGVGKSALTIQLIHLA-C*08:02Colon Cancer
Prostatic acid phosphatase as a target molecule in specific immunotherapy for patients with nonprostate adenocarcinoma. J Immunother 2005LYCESVHNFHLA-A*24:02Colon Cancer
T cell neoepitope discovery in colorectal cancer by high throughput profiling of somatic mutations in expressed genes. Gut 2017GDRFCLGQLSNAHRTHLA-A*02:01Colon Cancer
T cell neoepitope discovery in colorectal cancer by high throughput profiling of somatic mutations in expressed genes. Gut 2017CLGQLSNAHLA-A*02:01Colon Cancer
T-cell response to human papillomavirus type 58 L1, E6, And E7 peptides in women with cleared infection, cervical intraepithelial neoplasia, or invasive cancer..Clin Vaccine Immunol.2010LCINSTATEHLA-A*11:01Cervical Cancer
T-cell response to human papillomavirus type 58 L1, E6, And E7 peptides in women with cleared infection, cervical intraepithelial neoplasia, or invasive cancer..Clin Vaccine Immunol.2010CTIVCPSCAHLA-A*11:01Cervical Cancer
T-cell response to human papillomavirus type 52 L1, E6, and E7 peptides in women with transient infection, cervical intraepithelial neoplasia, and invasive cancer..J Med Virol.2011TSESQLFNKHLA-A*11:01Cervical Cancer
T-cell response to human papillomavirus type 52 L1, E6, and E7 peptides in women with transient infection, cervical intraepithelial neoplasia, and invasive cancer..J Med Virol.2011MTLCAEVKKHLA-A*11:01Cervical Cancer
T-cell response to human papillomavirus type 52 L1, E6, and E7 peptides in women with transient infection, cervical intraepithelial neoplasia, and invasive cancer..J Med Virol.2011LQFIFQLCKHLA-A*11:01Cervical Cancer
T-cell response to human papillomavirus type 52 L1, E6, and E7 peptides in women with transient infection, cervical intraepithelial neoplasia, and invasive cancer..J Med Virol.2011KTLEERVKKHLA-A*11:01Cervical Cancer
T-cell response to human papillomavirus type 52 L1, E6, and E7 peptides in women with transient infection, cervical intraepithelial neoplasia, and invasive cancer..J Med Virol.2011RLQCVQCKKHLA-A*11:01Cervical Cancer
T-cell response to human papillomavirus type 52 L1, E6, and E7 peptides in women with transient infection, cervical intraepithelial neoplasia, and invasive cancer..J Med Virol.2011MRGDKATIKHLA-A*11:01Cervical Cancer
T-cell response to human papillomavirus type 52 L1, E6, and E7 peptides in women with transient infection, cervical intraepithelial neoplasia, and invasive cancer..J Med Virol.2011QLGDSSDEEHLA-A*11:01Cervical Cancer
Impaired cytotoxic T lymphocyte inductivity by dendritic cells derived from patients with hepatitis C virus-positive hepatocellular carcinoma. Hepatol Res 2007IISAVVGILHLA-A*02:01Hepatocellular Carcinoma
Impaired cytotoxic T lymphocyte inductivity by dendritic cells derived from patients with hepatitis C virus-positive hepatocellular carcinoma. Hepatol Res 2007TYLPTNASLHLA-A*02:01Hepatocellular Carcinoma
Recognition of HLA-A2-restricted mammaglobin-A-derived epitopes by CD8+ cytotoxic T lymphocytes from breast cancer patients. Breast Cancer Res Treat 2004LIYDSSLCDLHLA-A*02:01Breast Cancer
Recognition of HLA-A2-restricted mammaglobin-A-derived epitopes by CD8+ cytotoxic T lymphocytes from breast cancer patients. Breast Cancer Res Treat 2004KLLMVLMLAHLA-A*02:01Breast Cancer
Recognition of HLA-A2-restricted mammaglobin-A-derived epitopes by CD8+ cytotoxic T lymphocytes from breast cancer patients. Breast Cancer Res Treat 2004LMVLMLAALHLA-A*02:01Breast Cancer
Inducible Hsp70 as target of anticancer immunotherapy: Identification of HLA-A*0201-restricted epitopes. Int J Cancer 2004LLLLDVAPLHLA-A*02:01Breast Cancer
Inducible Hsp70 as target of anticancer immunotherapy: Identification of HLA-A*0201-restricted epitopes. Int J Cancer 2004LLDVAPLSLHLA-A*02:01Breast Cancer
Neoantigens elicit T cell responses in breast cancer. Sci Rep 2021AQCPDVLVHLA-A*02:06Breast Cancer
Neoantigens elicit T cell responses in breast cancer. Sci Rep 2021SISCHVFCLHLA-A*02:06Breast Cancer
Identification and validation of expressed HLA-binding breast cancer neoepitopes for potential use in individualized cancer therapy. J Immunother Cancer 2021RTQDAEFLKHLA-A*11:01Breast Cancer
Case Report: Pathological Complete Response in a Lung Metastasis of Phyllodes Tumor Patient Following Treatment Containing Peptide Neoantigen Nano-Vaccine. Front Oncol 2022KLKAIPTTLHLA-A*02:01Breast Cancer
Case Report: Pathological Complete Response in a Lung Metastasis of Phyllodes Tumor Patient Following Treatment Containing Peptide Neoantigen Nano-Vaccine. Front Oncol 2022QLQKANVLLHLA-A*02:01Breast Cancer
Case Report: Pathological Complete Response in a Lung Metastasis of Phyllodes Tumor Patient Following Treatment Containing Peptide Neoantigen Nano-Vaccine. Front Oncol 2022VARLSSKSVHLA-C*03:04Breast Cancer
First-in-man application of a novel therapeutic cancer vaccine formulation with the capacity to induce multi-functional T cell responses in ovarian, breast and prostate cancer patients. J Transl Med 2012ALMEQQHYVHLA-A*02:01Breast Cancer
First-in-man application of a novel therapeutic cancer vaccine formulation with the capacity to induce multi-functional T cell responses in ovarian, breast and prostate cancer patients. J Transl Med 2012YLIELIDRVHLA-A*02:01Breast Cancer
First-in-man application of a novel therapeutic cancer vaccine formulation with the capacity to induce multi-functional T cell responses in ovarian, breast and prostate cancer patients. J Transl Med 2012FLAEDALNTVHLA-A*02:01Breast Cancer
Immunogenicity and therapeutic targeting of a public neoantigen derived from mutated PIK3CA. Nat Med 2022ALHGGWTTKHLA-A*03:01Breast Cancer
The shaping of a polyvalent and highly individual T-cell repertoire in the bone marrow of breast cancer patients. Cancer Res 2006GLQHWVPELHLA-A*02:01Breast Cancer
Human CTLs to wild-type and enhanced epitopes of a novel prostate and breast tumor-associated protein, TARP, lyse human breast cancer cells. Cancer Res 2004FLRNFSLMLHLA-A*02:01Breast Cancer
Human CTLs to wild-type and enhanced epitopes of a novel prostate and breast tumor-associated protein, TARP, lyse human breast cancer cells. Cancer Res 2004FVFLRNFSLHLA-A*02:01Breast Cancer
Human CTLs to wild-type and enhanced epitopes of a novel prostate and breast tumor-associated protein, TARP, lyse human breast cancer cells. Cancer Res 2004FLANFSLMLHLA-A*02:01Breast Cancer
Human CTLs to wild-type and enhanced epitopes of a novel prostate and breast tumor-associated protein, TARP, lyse human breast cancer cells. Cancer Res 2004FLRNFSLMVHLA-A*02:01Breast Cancer
The shaping of a polyvalent and highly individual T-cell repertoire in the bone marrow of breast cancer patients. Cancer Res 2006NLLRRMWVTHLA-A*02:01Breast Cancer
The shaping of a polyvalent and highly individual T-cell repertoire in the bone marrow of breast cancer patients. Cancer Res 2006NLFETPVEAHLA-A*02:01Breast Cancer
The shaping of a polyvalent and highly individual T-cell repertoire in the bone marrow of breast cancer patients. Cancer Res 2006FLTPKKLQCVHLA-A*02:01Breast Cancer
The shaping of a polyvalent and highly individual T-cell repertoire in the bone marrow of breast cancer patients. Cancer Res 2006STPPPGTRVHLA-A*02:01Breast Cancer
The shaping of a polyvalent and highly individual T-cell repertoire in the bone marrow of breast cancer patients. Cancer Res 2006GVLVGVALIHLA-A*02:01Breast Cancer
The shaping of a polyvalent and highly individual T-cell repertoire in the bone marrow of breast cancer patients. Cancer Res 2006LLGATCMFVHLA-A*02:01Breast Cancer
The shaping of a polyvalent and highly individual T-cell repertoire in the bone marrow of breast cancer patients. Cancer Res 2006KMVELVHFLHLA-A*02:01Breast Cancer
The shaping of a polyvalent and highly individual T-cell repertoire in the bone marrow of breast cancer patients. Cancer Res 2006DLIFGLNALHLA-A*02:01Breast Cancer
The shaping of a polyvalent and highly individual T-cell repertoire in the bone marrow of breast cancer patients. Cancer Res 2006KTLLSLALVHLA-A*02:01Breast Cancer
The shaping of a polyvalent and highly individual T-cell repertoire in the bone marrow of breast cancer patients. Cancer Res 2006LLLLTVLTVHLA-A*02:01Breast Cancer
The shaping of a polyvalent and highly individual T-cell repertoire in the bone marrow of breast cancer patients. Cancer Res 2006KIFGSLAFLHLA-A*02:01Breast Cancer
The shaping of a polyvalent and highly individual T-cell repertoire in the bone marrow of breast cancer patients. Cancer Res 2006LLLGPLGPLHLA-A*02:01Breast Cancer
The shaping of a polyvalent and highly individual T-cell repertoire in the bone marrow of breast cancer patients. Cancer Res 2006ALPPPLMLLHLA-A*02:01Breast Cancer
Occasional memory cytotoxic T-cell responses of patients with human papillomavirus type 16-positive cervical lesions against a human leukocyte antigen-A *0201-restricted E7-encoded epitope. Cancer Res 1996YMLDLQPETTHLA-A*02:01Gastric Cancer
Immunological evaluation of vaccination with pre-designated peptides frequently selected as vaccine candidates in an individualized peptide vaccination regimen. Int J Oncol 2004VYDYNCHVDLHLA-A*24:02Gastric Cancer
Immunological evaluation of vaccination with pre-designated peptides frequently selected as vaccine candidates in an individualized peptide vaccination regimen. Int J Oncol 2004AYIDFEMKIHLA-A*24:02Gastric Cancer
Immunological evaluation of vaccination with pre-designated peptides frequently selected as vaccine candidates in an individualized peptide vaccination regimen. Int J Oncol 2004DYLRSVLEDFHLA-A*24:02Gastric Cancer
Recognition of HLA-A2-restricted mammaglobin-A-derived epitopes by CD8+ cytotoxic T lymphocytes from breast cancer patients. Breast Cancer Res Treat 2004FLNQTDETLHLA-A*02:01Breast Cancer
Recognition of HLA-A2-restricted mammaglobin-A-derived epitopes by CD8+ cytotoxic T lymphocytes from breast cancer patients. Breast Cancer Res Treat 2004TINPQVSKTHLA-A*02:01Breast Cancer
Vaccination with p53-peptide-pulsed dendritic cells, of patients with advanced breast cancer: report from a phase I study. Cancer Immunol Immunother 2004RMPEAAPPVHLA-A*02:01Breast Cancer
Vaccination with p53-peptide-pulsed dendritic cells, of patients with advanced breast cancer: report from a phase I study. Cancer Immunol Immunother 2004LLGRNSFEVHLA-A*02:01Breast Cancer
Immunological evaluation of vaccination with pre-designated peptides frequently selected as vaccine candidates in an individualized peptide vaccination regimen. Int J Oncol 2004DYSARWNEIHLA-A*24:02Gastric Cancer
Prostatic acid phosphatase as a target molecule in specific immunotherapy for patients with nonprostate adenocarcinoma. J Immunother 2005LYCESVHNFHLA-A*24:02Gastric Cancer
Antigen-Specific T Cell Immunotherapy Targeting Claudin18.2 in Gastric Cancer. Cancers (Basel) 2022YTFGAALFVHLA-A*02:01Gastric Cancer
Antigen-Specific T Cell Immunotherapy Targeting Claudin18.2 in Gastric Cancer. Cancers (Basel) 2022GLLVSIFALHLA-A*02:01Gastric Cancer
Antigen-Specific T Cell Immunotherapy Targeting Claudin18.2 in Gastric Cancer. Cancers (Basel) 2022TLTSGIMFIHLA-A*02:01Gastric Cancer
Antigen-Specific T Cell Immunotherapy Targeting Claudin18.2 in Gastric Cancer. Cancers (Basel) 2022GLPAMLQAVHLA-A*02:01Gastric Cancer
Antigen-Specific T Cell Immunotherapy Targeting Claudin18.2 in Gastric Cancer. Cancers (Basel) 2022TLTSGIMFIVHLA-A*02:01Gastric Cancer
Antigen-Specific T Cell Immunotherapy Targeting Claudin18.2 in Gastric Cancer. Cancers (Basel) 2022STGFGSNTKHLA-A*11:01Gastric Cancer
Antigen-Specific T Cell Immunotherapy Targeting Claudin18.2 in Gastric Cancer. Cancers (Basel) 2022LLVSIFALKHLA-A*11:01Gastric Cancer
Antigen-Specific T Cell Immunotherapy Targeting Claudin18.2 in Gastric Cancer. Cancers (Basel) 2022VAYKPGGFKHLA-A*11:01Gastric Cancer
Antigen-Specific T Cell Immunotherapy Targeting Claudin18.2 in Gastric Cancer. Cancers (Basel) 2022SVAYKPGGFKHLA-A*11:01Gastric Cancer
Antigen-Specific T Cell Immunotherapy Targeting Claudin18.2 in Gastric Cancer. Cancers (Basel) 2022HASGHSVAYKHLA-A*11:01Gastric Cancer
Antigen-Specific T Cell Immunotherapy Targeting Claudin18.2 in Gastric Cancer. Cancers (Basel) 2022GLLVSIFALKHLA-A*11:01Gastric Cancer
Optimized polyepitope neoantigen DNA vaccines elicit neoantigen-specific immune responses in preclinical models and in clinical translation..Genome Med.2021LLMREVPLRCTISLWDTYQSEPDGFHLA-A*01:01Pancreatic Cancer
Optimized polyepitope neoantigen DNA vaccines elicit neoantigen-specific immune responses in preclinical models and in clinical translation..Genome Med.2021LVRAVQFTETFLMERDKQSKWSGIPHLA-B*44:03Pancreatic Cancer
Optimized polyepitope neoantigen DNA vaccines elicit neoantigen-specific immune responses in preclinical models and in clinical translation..Genome Med.2021HTGEKPYRCKVCGTAFTWHSQLARHHLA-A*32:01Pancreatic Cancer
Cytotoxic CD4+ and CD8+ T lymphocytes, generated by mutant p21-ras (12Val) peptide vaccination of a patient, recognize 12Val-dependent nested epitopes present within the vaccine peptide and kill autologous tumour cells carrying this mutation..Int J Cancer.1997VVVGAVGVGHLA-B35Pancreatic Cancer
Expansion of KRAS hotspot mutations reactive T cells from human pancreatic tumors using autologous T cells as the antigen-presenting cells..Cancer Immunol Immunother.2022VVGAVGVGKHLA-A*11:01Pancreatic Cancer
Expansion of KRAS hotspot mutations reactive T cells from human pancreatic tumors using autologous T cells as the antigen-presenting cells..Cancer Immunol Immunother.2022VVVGAVGVGKHLA-A*11:01Pancreatic Cancer
Retroviral vector backbone immunogenicity: identification of cytotoxic T-cell epitopes in retroviral vector-packaging sequences..Gene Ther.2005APIWPYEILYHLA-B*35:01Cervical Cancer
Disease-stage variance in functional CD4(+) T-cell responses against novel pan-human leukocyte antigen-D region presented human papillomavirus-16 E7 epitopes..Clin Cancer Res.2004DRAHYNIVTFCCKCDHLA-DR15Cervical Cancer
Cross-typic specificity and immunotherapeutic potential of a human HPV16 E7-specific CTL line..Int J Cancer.2005YMLDLQPETTHLA-A*02:01Cervical Cancer
Cross-typic specificity and immunotherapeutic potential of a human HPV16 E7-specific CTL line..Int J Cancer.2005E7 proteinHLA-A*02:01Cervical Cancer
Cross-typic specificity and immunotherapeutic potential of a human HPV16 E7-specific CTL line..Int J Cancer.2005YILDLQPETTHLA-A*02:01Cervical Cancer
Cross-typic specificity and immunotherapeutic potential of a human HPV16 E7-specific CTL line..Int J Cancer.2005YVLDLQPEATHLA-A*02:01Cervical Cancer
Cross-typic specificity and immunotherapeutic potential of a human HPV16 E7-specific CTL line..Int J Cancer.2005Protein E7HLA-A*02:01Cervical Cancer
Occasional memory cytotoxic T-cell responses of patients with human papillomavirus type 16-positive cervical lesions against a human leukocyte antigen-A *0201-restricted E7-encoded epitope..Cancer Res.1996YMLDLQPETTHLA-A*02:01Cervical Cancer
Vaccination with p53-peptide-pulsed dendritic cells, of patients with advanced breast cancer: report from a phase I study. Cancer Immunol Immunother 2004GLAPPQHLIRVHLA-A*02:01Breast Cancer
Vaccination with p53-peptide-pulsed dendritic cells, of patients with advanced breast cancer: report from a phase I study. Cancer Immunol Immunother 2004SLPPPGTRVHLA-A*02:01Breast Cancer
Vaccination with p53-peptide-pulsed dendritic cells, of patients with advanced breast cancer: report from a phase I study. Cancer Immunol Immunother 2004KLCPVQLWVHLA-A*02:01Breast Cancer
Vaccination with p53-peptide-pulsed dendritic cells, of patients with advanced breast cancer: report from a phase I study. Cancer Immunol Immunother 2004YLGSYGFRLHLA-A*02:01Breast Cancer
Human papillomavirus 16 E6-specific CD45RA+ CCR7+ high avidity CD8+ T cells fail to control tumor growth despite interferon-gamma production in patients with cervical cancer..J Immunother.2007KLPQLCTELHLA-A*02:01Cervical Cancer
Identification in humans of HPV-16 E6 and E7 protein epitopes recognized by cytolytic T lymphocytes in association with HLA-B18 and determination of the HLA-B18-specific binding motif..Eur J Immunol.2000ISEYRHYCYHLA-B18Cervical Cancer
Naturally processed and HLA-B8-presented HPV16 E7 epitope recognized by T cells from patients with cervical cancer..Int J Cancer.2005TLHEYMLDLHLA-B8Cervical Cancer
Naturally processed and HLA-B8-presented HPV16 E7 epitope recognized by T cells from patients with cervical cancer..Int J Cancer.2005CCKCDSTLHLA-B8Cervical Cancer
Identification of a naturally processed HLA-A*0201 HPV18 E7 T cell epitope by tumor cell mediated in vitro vaccination..Int J Cancer.2003FQQLFLNTLHLA-A*02:01Cervical Cancer
Identification of two homologous antigenic peptides derived from L1 HPV-16 and 18 proteins specific for the HLA-B*3901 allele..Arch Virol.2002IHSMNSTILHLA-B*39:01Cervical Cancer
Identification of two homologous antigenic peptides derived from L1 HPV-16 and 18 proteins specific for the HLA-B*3901 allele..Arch Virol.2002IHSMNSSILHLA-B*39:01Cervical Cancer
Use of fluorogenic histocompatibility leukocyte antigen-A*0201/HPV 16 E7 peptide complexes to isolate rare human cytotoxic T-lymphocyte-recognizing endogenous human papillomavirus antigens..Cancer Res.2000YMLDLQPETTHLA-A*02:01Cervical Cancer
HPV16 E6 29-38-specific T cells kill cervical carcinoma cells despite partial evasion of T-cell effector function..Int J Cancer.2008Protein E6HLA-A*02:01Cervical Cancer
Infiltration of cervical cancer tissue with human papillomavirus-specific cytotoxic T-lymphocytes..Cancer Res.1997YMLDLQPETTHLA-A*02:01Cervical Cancer
Identification of an HLA-A24-restricted cytotoxic T lymphocyte epitope from human papillomavirus type-16 E6: the combined effects of bortezomib and interferon-gamma on the presentation of a cryptic epitope..Int J Cancer.2007VYDFAFRDLHLA-A*24:02Cervical Cancer
Vaccination with p53-peptide-pulsed dendritic cells, of patients with advanced breast cancer: report from a phase I study. Cancer Immunol Immunother 2004STPPPGATRVHLA-A*02:01Breast Cancer
Vaccination with p53-peptide-pulsed dendritic cells, of patients with advanced breast cancer: report from a phase I study. Cancer Immunol Immunother 2004KTCPVQLWVHLA-A*02:01Breast Cancer
Vaccination with p53-peptide-pulsed dendritic cells, of patients with advanced breast cancer: report from a phase I study. Cancer Immunol Immunother 2004YQGSYGFRLHLA-A*02:01Breast Cancer
Resolution of cervical dysplasia is associated with T-cell proliferative responses to human papillomavirus type 16 E2..J Gen Virol.2007TLLQQYCLYLHLA-A*02:01Cervical Cancer
Resolution of cervical dysplasia is associated with T-cell proliferative responses to human papillomavirus type 16 E2..J Gen Virol.2007ALQAIELQLHLA-A*02:01Cervical Cancer
Resolution of cervical dysplasia is associated with T-cell proliferative responses to human papillomavirus type 16 E2..J Gen Virol.2007TLQDVSLEVHLA-A*02:01Cervical Cancer
Resolution of cervical dysplasia is associated with T-cell proliferative responses to human papillomavirus type 16 E2..J Gen Virol.2007YICEEASVTVHLA-A*02:01Cervical Cancer
Immunological evaluation of vaccination with pre-designated peptides frequently selected as vaccine candidates in an individualized peptide vaccination regimen. Int J Oncol 2004VLEGMEVVHLA-A*02:01Gastric Cancer
Immunological evaluation of vaccination with pre-designated peptides frequently selected as vaccine candidates in an individualized peptide vaccination regimen. Int J Oncol 2004KLVERLGAAHLA-A*02:01Gastric Cancer
Human papillomavirus type 33 E7 peptides presented by HLA-DR*0402 to tumor-infiltrating T cells in cervical cancer..J Virol.2000ASDLRTIQQLLMGTVHLA-DRB1*04:02Cervical Cancer
Human papillomavirus type 33 E7 peptides presented by HLA-DR*0402 to tumor-infiltrating T cells in cervical cancer..J Virol.2000ASDLRTIQQLLMGTVHLA-DRB1*04:01Cervical Cancer
Induction of human papillomavirus type 16-specific immunologic responses in a normal and an human papillomavirus-infected populations..Immunology.2005YMLDLQPETTHLA-A*02:01Cervical Cancer
Cytotoxic T-lymphocyte responses to human papillomavirus type 16 E5 and E7 proteins and HLA-A*0201-restricted T-cell peptides in cervical cancer patients..J Virol.2007YIIFVYIPLHLA-A*02:01Cervical Cancer
Analysis of HLA-DRB1*0901-binding HPV-16 E7 helper T cell epitope..J Obstet Gynaecol Res.2004CDSTLRLCVQSTHVDIRTLEHLA-DRB1*09:01Cervical Cancer
Analysis of HLA-DRB1*0901-binding HPV-16 E7 helper T cell epitope..J Obstet Gynaecol Res.2004DLLMGTLGIVCPICSQKPHLA-DRB1*09:01Cervical Cancer
Immunological evaluation of vaccination with pre-designated peptides frequently selected as vaccine candidates in an individualized peptide vaccination regimen. Int J Oncol 2004DLLSHAFFAHLA-A*02:01Gastric Cancer
Generation of tumor-specific cytolytic T lymphocytes from peripheral blood of cervical cancer patients by in vitro stimulation with a synthetic human papillomavirus type 16 E7 epitope..Am J Obstet Gynecol.1996YMLDLQPETTHLA-A*02:01Cervical Cancer
Definition of the HLA-A2 restricted peptides recognized by human CD8+ effector T cells by flow-assisted sorting of the CD8+ CD45RA+ CD28- T cell subpopulation..Clin Exp Immunol.2003YMLDLQPETHLA-A*02:01Cervical Cancer
Infiltration of cervical cancer tissue with human papillomavirus-specific cytotoxic T-lymphocytes..Cancer Res.1997E7HLA-A*02:01Cervical Cancer
Human papilloma virus specific T cells infiltrating cervical cancer and draining lymph nodes show remarkably frequent use of HLA-DQ and -DP as a restriction element..Int J Cancer.2008YMLDLQPETHLA-A*02:01Cervical Cancer
HLA-DQB1*02-restricted HPV-16 E7 peptide-specific CD4+ T-cell immune responses correlate with regression of HPV-16-associated high-grade squamous intraepithelial lesions..Clin Cancer Res.2007STHVDIRTLEDLLMGHLA-DQB1*02:01Cervical Cancer
Recognition of a cervical cancer derived tumor cell line by a human papillomavirus type 16 E6 52-61-specific CD8 T cell clone..Cancer Immun.2006FAFRDLCIVYHLA-B57Cervical Cancer
Human papillomavirus type 33 E7 peptides presented by HLA-DR*0402 to tumor-infiltrating T cells in cervical cancer..J Virol.2000LRTIQQLLMGTVNIVHLA-DRB1*04:02Cervical Cancer
Human papillomavirus L1L2-E7 virus-like particles partially mature human dendritic cells and elicit E7-specific T-helper responses from patients with cervical intraepithelial neoplasia or cervical cancer in vitro..Hum Immunol.2005DRAHYNIVTFCCKCDHLA-DR15Cervical Cancer
Use of fluorogenic histocompatibility leukocyte antigen-A*0201/HPV 16 E7 peptide complexes to isolate rare human cytotoxic T-lymphocyte-recognizing endogenous human papillomavirus antigens..Cancer Res.2000E7 proteinHLA-A*02:01Cervical Cancer
Immunological evaluation of vaccination with pre-designated peptides frequently selected as vaccine candidates in an individualized peptide vaccination regimen. Int J Oncol 2004RLQEWCSVIHLA-A*02:01Gastric Cancer
Recognition of a cervical cancer derived tumor cell line by a human papillomavirus type 16 E6 52-61-specific CD8 T cell clone..Cancer Immun.2006FAFSDLYVVYHLA-B57Cervical Cancer
Recognition of a cervical cancer derived tumor cell line by a human papillomavirus type 16 E6 52-61-specific CD8 T cell clone..Cancer Immun.2006FAFSDLCIVYHLA-B57Cervical Cancer
Recognition of a cervical cancer derived tumor cell line by a human papillomavirus type 16 E6 52-61-specific CD8 T cell clone..Cancer Immun.2006FAFKDLCIVYHLA-B57Cervical Cancer
Recognition of a cervical cancer derived tumor cell line by a human papillomavirus type 16 E6 52-61-specific CD8 T cell clone..Cancer Immun.2006VAFTEIKIVYHLA-B57Cervical Cancer
Recognition of a cervical cancer derived tumor cell line by a human papillomavirus type 16 E6 52-61-specific CD8 T cell clone..Cancer Immun.2006FACYDLCIVYHLA-B57Cervical Cancer
Recognition of a cervical cancer derived tumor cell line by a human papillomavirus type 16 E6 52-61-specific CD8 T cell clone..Cancer Immun.2006FVFADLRIVYHLA-B57Cervical Cancer
Human papilloma virus specific T cells infiltrating cervical cancer and draining lymph nodes show remarkably frequent use of HLA-DQ and -DP as a restriction element..Int J Cancer.2008QERPRKLPQLHLA-B7Cervical Cancer
Human papillomavirus type 16 E7 peptide-directed CD8+ T cells from patients with cervical cancer are cross-reactive with the coronavirus NS2 protein..J Virol.2003YMLDLQPETHLA-A*02:01Cervical Cancer
Human papilloma virus specific T cells infiltrating cervical cancer and draining lymph nodes show remarkably frequent use of HLA-DQ and -DP as a restriction element..Int J Cancer.2008RWTGRCMSCCHLA-B27Cervical Cancer
Human papilloma virus specific T cells infiltrating cervical cancer and draining lymph nodes show remarkably frequent use of HLA-DQ and -DP as a restriction element..Int J Cancer.2008SSRTRRETQLHLA-B14Cervical Cancer
The common HLA class I-restricted tumor-infiltrating T cell response in HPV16-induced cancer..Cancer Immunol Immunother.2022YMLDLQPETHLA-A*02:01Cervical Cancer
Human papilloma virus specific T cells infiltrating cervical cancer and draining lymph nodes show remarkably frequent use of HLA-DQ and -DP as a restriction element..Int J Cancer.2008IRTLEDLLMGTHLA-DR12Cervical Cancer
Human papilloma virus specific T cells infiltrating cervical cancer and draining lymph nodes show remarkably frequent use of HLA-DQ and -DP as a restriction element..Int J Cancer.2008Protein E6HLA-B27Cervical Cancer
Human papilloma virus specific T cells infiltrating cervical cancer and draining lymph nodes show remarkably frequent use of HLA-DQ and -DP as a restriction element..Int J Cancer.2008Protein E6HLA-B14Cervical Cancer
Human papilloma virus specific T cells infiltrating cervical cancer and draining lymph nodes show remarkably frequent use of HLA-DQ and -DP as a restriction element..Int J Cancer.2008Protein E7HLA-DR12Cervical Cancer
Definition of the HLA-A2 restricted peptides recognized by human CD8+ effector T cells by flow-assisted sorting of the CD8+ CD45RA+ CD28- T cell subpopulation..Clin Exp Immunol.2003HVDIRTLEDHLA-A*02:01Cervical Cancer
Specificity of human cytotoxic T lymphocytes induced by a human papillomavirus type 16 E7-derived peptide..J Gen Virol.1997TLGIVCPIHLA-A*02:01Cervical Cancer
Definition of the HLA-A2 restricted peptides recognized by human CD8+ effector T cells by flow-assisted sorting of the CD8+ CD45RA+ CD28- T cell subpopulation..Clin Exp Immunol.2003GTLGIVCPIHLA-A*02:01Cervical Cancer
Infiltration of cervical cancer tissue with human papillomavirus-specific cytotoxic T-lymphocytes..Cancer Res.1997TLGIVCPIHLA-A*02:01Cervical Cancer
Induction of human papillomavirus type 16-specific immunologic responses in a normal and an human papillomavirus-infected populations..Immunology.2005TLGIVCPIHLA-A*02:01Cervical Cancer
HPV16 E6 29-38-specific T cells kill cervical carcinoma cells despite partial evasion of T-cell effector function..Int J Cancer.2008TIHDIILECVHLA-A*02:01Cervical Cancer
Antigen processing defects in cervical carcinomas limit the presentation of a CTL epitope from human papillomavirus 16 E6..J Immunol.2001TIHDIILECVHLA-A*02:01Cervical Cancer
Human papilloma virus specific T cells infiltrating cervical cancer and draining lymph nodes show remarkably frequent use of HLA-DQ and -DP as a restriction element..Int J Cancer.2008TIHDIILECVHLA-A*02:01Cervical Cancer
T-cell response to human papillomavirus type 58 L1, E6, And E7 peptides in women with cleared infection, cervical intraepithelial neoplasia, or invasive cancer..Clin Vaccine Immunol.2010ILIRCIICQHLA-A*02:01Cervical Cancer
T-cell response to human papillomavirus type 52 L1, E6, and E7 peptides in women with transient infection, cervical intraepithelial neoplasia, and invasive cancer..J Med Virol.2011ITIRCIICQHLA-A*02:01Cervical Cancer
Human papillomavirus type 16 E6/E7-specific cytotoxic T lymphocytes for adoptive immunotherapy of HPV-associated malignancies..J Immunother.2013MHGDTPTLHEYMLDLHLA-A*02:01Cervical Cancer
Human papillomavirus type 16 E6/E7-specific cytotoxic T lymphocytes for adoptive immunotherapy of HPV-associated malignancies..J Immunother.2013TPTLHEYMLDLQPETHLA-A*02:01Cervical Cancer
Human papillomavirus type 16 E6/E7-specific cytotoxic T lymphocytes for adoptive immunotherapy of HPV-associated malignancies..J Immunother.2013ELQTTIHDIILECVYHLA-A*02:01Cervical Cancer
Immunological evaluation of vaccination with pre-designated peptides frequently selected as vaccine candidates in an individualized peptide vaccination regimen..Int J Oncol.2004VLEGMEVVHLA-A*02:01Cervical Cancer
Immunological evaluation of vaccination with pre-designated peptides frequently selected as vaccine candidates in an individualized peptide vaccination regimen..Int J Oncol.2004KLVERLGAAHLA-A*02:01Cervical Cancer
Immunological evaluation of vaccination with pre-designated peptides frequently selected as vaccine candidates in an individualized peptide vaccination regimen..Int J Oncol.2004DLLSHAFFAHLA-A*02:01Cervical Cancer
Immunological evaluation of vaccination with pre-designated peptides frequently selected as vaccine candidates in an individualized peptide vaccination regimen..Int J Oncol.2004RLQEWCSVIHLA-A*02:01Cervical Cancer
Cytolytic T-cell response against Epstein-Barr virus in lung cancer patients and healthy subjects...J Exp Clin Cancer Res.2010RYSIFFDYMHLA-A*24:02Lung Cancer
Impaired cytotoxic T lymphocyte inductivity by dendritic cells derived from patients with hepatitis C virus-positive hepatocellular carcinoma. Hepatol Res 2007TYLPTNASLHLA-A*24:02Hepatocellular Carcinoma
Identification of human papillomavirus 16-E6 protein-derived peptides with the potential to generate cytotoxic T-lymphocytes toward human leukocyte antigen-A24+ cervical cancer..Int J Oncol.2005VYDFAFQDLHLA-A*24:02Cervical Cancer
Identification of human papillomavirus 16-E6 protein-derived peptides with the potential to generate cytotoxic T-lymphocytes toward human leukocyte antigen-A24+ cervical cancer..Int J Oncol.2005EYRHYCYSLHLA-A*24:02Cervical Cancer
Novel oligomannose liposome-DNA complex DNA vaccination efficiently evokes anti-HPV E6 and E7 CTL responses..Exp Mol Pathol.2012VYDFAFRDLHLA-A*24:02Cervical Cancer
Novel oligomannose liposome-DNA complex DNA vaccination efficiently evokes anti-HPV E6 and E7 CTL responses..Exp Mol Pathol.2012PYAVCDKCLHLA-A*24:02Cervical Cancer
Novel oligomannose liposome-DNA complex DNA vaccination efficiently evokes anti-HPV E6 and E7 CTL responses..Exp Mol Pathol.2012EYRHYCYSLHLA-A*24:02Cervical Cancer
Novel oligomannose liposome-DNA complex DNA vaccination efficiently evokes anti-HPV E6 and E7 CTL responses..Exp Mol Pathol.2012CYSLYGTTLHLA-A*24:02Cervical Cancer
Novel oligomannose liposome-DNA complex DNA vaccination efficiently evokes anti-HPV E6 and E7 CTL responses..Exp Mol Pathol.2012QYNKPLCDLHLA-A*24:02Cervical Cancer
Novel oligomannose liposome-DNA complex DNA vaccination efficiently evokes anti-HPV E6 and E7 CTL responses..Exp Mol Pathol.2012LMGTLGIVCPIHLA-A*24:02Cervical Cancer
Identification of human papillomavirus 16-E6 protein-derived peptides with the potential to generate cytotoxic T-lymphocytes toward human leukocyte antigen-A24+ cervical cancer..Int J Oncol.2005QYNKPLCDLLHLA-A*24:02Cervical Cancer
T-cell response to human papillomavirus type 58 L1, E6, And E7 peptides in women with cleared infection, cervical intraepithelial neoplasia, or invasive cancer..Clin Vaccine Immunol.2010KYTFWEVNLHLA-A*24:02Cervical Cancer
T-cell response to human papillomavirus type 52 L1, E6, and E7 peptides in women with transient infection, cervical intraepithelial neoplasia, and invasive cancer..J Med Virol.2011VYKFLFTDLHLA-A*24:02Cervical Cancer
A Human Papillomavirus Type 16 E6 52-62 CD4 T-Cell Epitope Restricted by the HLA-DR11 Molecule Described in an Epitope Hotspot..MOJ Immunol.2014FAFRDLCIVYRHLA-DR11Cervical Cancer
A Human Papillomavirus Type 16 E6 52-62 CD4 T-Cell Epitope Restricted by the HLA-DR11 Molecule Described in an Epitope Hotspot..MOJ Immunol.2014QFAFKDLCIVYRDCIHLA-DR11Cervical Cancer
Immunological evaluation of vaccination with pre-designated peptides frequently selected as vaccine candidates in an individualized peptide vaccination regimen..Int J Oncol.2004VYDYNCHVDLHLA-A*24:02Cervical Cancer
Immunological evaluation of vaccination with pre-designated peptides frequently selected as vaccine candidates in an individualized peptide vaccination regimen..Int J Oncol.2004AYIDFEMKIHLA-A*24:02Cervical Cancer
Immunological evaluation of vaccination with pre-designated peptides frequently selected as vaccine candidates in an individualized peptide vaccination regimen..Int J Oncol.2004HYTNASDGLHLA-A*24:02Cervical Cancer
Immunological evaluation of vaccination with pre-designated peptides frequently selected as vaccine candidates in an individualized peptide vaccination regimen..Int J Oncol.2004DYLRSVLEDFHLA-A*24:02Cervical Cancer
T-cell response to human papillomavirus type 52 L1, E6, and E7 peptides in women with transient infection, cervical intraepithelial neoplasia, and invasive cancer..J Med Virol.2011PYGVCIMCLHLA-A*24:02Cervical Cancer
T-cell response to human papillomavirus type 52 L1, E6, and E7 peptides in women with transient infection, cervical intraepithelial neoplasia, and invasive cancer..J Med Virol.2011CYEQLGDSSHLA-A*24:02Cervical Cancer
T-cell response to human papillomavirus type 52 L1, E6, and E7 peptides in women with transient infection, cervical intraepithelial neoplasia, and invasive cancer..J Med Virol.2011YYYAGSSRLHLA-A*24:02Cervical Cancer
T-cell response to human papillomavirus type 52 L1, E6, and E7 peptides in women with transient infection, cervical intraepithelial neoplasia, and invasive cancer..J Med Virol.2011QYRVFRIKLHLA-A*24:02Cervical Cancer
Rapid generation of genetically engineered T cells for the treatment of virus-related cancers..Cancer Sci.2022IILECVYCKHLA-A*11:01Cervical Cancer
Rapid generation of genetically engineered T cells for the treatment of virus-related cancers..Cancer Sci.2022IVCPICSQKHLA-A*11:01Cervical Cancer
Rapid generation of genetically engineered T cells for the treatment of virus-related cancers..Cancer Sci.2022SVYGDTLEKHLA-A*11:01Cervical Cancer
Rapid generation of genetically engineered T cells for the treatment of virus-related cancers..Cancer Sci.2022HTMLCMCCKHLA-A*11:01Cervical Cancer
Rapid generation of genetically engineered T cells for the treatment of virus-related cancers..Cancer Sci.2022GTTLEQQYNKHLA-A*11:01Cervical Cancer
Definition of the HLA-A2 restricted peptides recognized by human CD8+ effector T cells by flow-assisted sorting of the CD8+ CD45RA+ CD28- T cell subpopulation..Clin Exp Immunol.2003LLMGTLGIVHLA-A*02:01Cervical Cancer